PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G022000.1
Common NameB456_012G022000, LOC105780237
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 558aa    MW: 61391.6 Da    PI: 5.1112
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G022000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-173986148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Gorai.012G022000.1 39 KGPWTSAEDAILIDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                        79******************************************9986 PP

2Myb_DNA-binding48.22.4e-1592135146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T eE+ l++++++++G++ W++ a+ ++ gRt++++k++w++
  Gorai.012G022000.1  92 KGAFTREEEHLIIELHAKMGNK-WARMAANLP-GRTDNEIKNYWNT 135
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2783486IPR017930Myb domain
SuperFamilySSF466892.62E-2938133IPR009057Homeodomain-like
SMARTSM007172.4E-153888IPR001005SANT/Myb domain
PfamPF002492.4E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-234093IPR009057Homeodomain-like
CDDcd001679.12E-124186No hitNo description
PROSITE profilePS5129425.50887141IPR017930Myb domain
SMARTSM007178.7E-1591139IPR001005SANT/Myb domain
PfamPF002491.8E-1492135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2494140IPR009057Homeodomain-like
CDDcd001671.79E-1094135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MSHTKNERED RMLSKNQKEL PLIDDGNCGD ADGGALLKKG PWTSAEDAIL IDYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTREEE HLIIELHAKM GNKWARMAAN  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVCLQALKES HRISAVSGGD KGTHDILQNN  180
TYEIPDVIFD SLKANQNVLP YVPELPDISA SSMMMKVLGS SQYSSFMPPA IHRQKRLRES  240
AAFSPGCTAA VKNDCPLFEQ FEDNMFNKAA KPFGQSFPFE PDPLTKKSQS FSAFQGSHAL  300
SHGNFSASEP TLEAVKLELP SLQYPETELE NWGTFSCSSS LLESVDAFIQ SPQTTSAVVL  360
DSHSPRNSGL LDALLHEAKT LSSAKNHASD KTSNSSTPCD IAERSNFNIC ETEWENCGET  420
LSPMCHSATS FFSESISASG SGSSLDEQPP AETFTEPHTK SESSDHVLTP EVEKEAPIWS  480
DGRCPDILLA SNWLEQGSGY DKDETIMIDA IATLLSDDLS SEYTSMLAGT SVSSQAWEPS  540
CCAWNNMPAV CQMSELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31371405107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591461e-46AJ459146.1 Gossypium hirsutum partial myb118 gene, clone pGhMYB118.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459894.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_012459895.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_012459897.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLA0A0D2RWG30.0A0A0D2RWG3_G
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-131myb domain protein 33
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]